{ Damit kann der Router Port-Freigaben beim Internet-Provider einrichten, und so die (nicht vorhandene) öffentliche IPv4-Adresse umgehen. }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] ] } } "action" : "rerender" ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { } "messageViewOptions" : "1111110111111111111110111110100101001101" Du bekommst damit eine statische öffentliche IPv4 Adresse und einen IPv6/56-Präfix. "actions" : [ ], ] { })(LITHIUM.jQuery); { ], "event" : "RevokeSolutionAction", { } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ }, ] { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); { "actions" : [ "context" : "envParam:selectedMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); ] .attr('aria-expanded','true') "revokeMode" : "true", "context" : "envParam:selectedMessage", "revokeMode" : "true", "}); { "action" : "rerender" "actions" : [ { "componentId" : "kudos.widget.button", }, "actions" : [ }, "context" : "envParam:quiltName", "action" : "rerender" "context" : "envParam:quiltName", Die Option ist dann nicht da wenn man DS-Lite hat. resetMenu(); } } }, { }, "includeRepliesModerationState" : "false", } { "context" : "envParam:quiltName,expandedQuiltName", "revokeMode" : "true", } "event" : "ProductAnswerComment", "selector" : "#kudosButtonV2_3", LITHIUM.AjaxSupport.ComponentEvents.set({ Von unterwegs rufe ich die myfritz-Adresse auf und komm ggf. { { "actions" : [ ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:feedbackData", } "action" : "rerender" "context" : "", "action" : "rerender" "event" : "deleteMessage", { "context" : "envParam:quiltName", "actions" : [ "actions" : [ "actions" : [ } LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '32Grd8moD9VSqCzc35Tp2PXb0noi4ql14ckkzCDYk7U. })(LITHIUM.jQuery); { "event" : "addThreadUserEmailSubscription", "componentId" : "forums.widget.message-view", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } { "actions" : [ }, "displayStyle" : "horizontal", "actions" : [ "event" : "deleteMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/227683","ajaxErrorEventName":"LITHIUM:ajaxError","token":"0Z4ZgYaMDFJ7BO2fhcRiGKXoIKcGYaUogRN322WJO_Q. })(LITHIUM.jQuery); "actions" : [ "actions" : [ "context" : "envParam:quiltName", }, Damit können Deine ans Internet angebundenen Geräte leicht adressiert und erreicht werden. { { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" "context" : "", "event" : "addThreadUserEmailSubscription", "action" : "rerender" "actions" : [ "initiatorBinding" : true, { "event" : "addThreadUserEmailSubscription", } "disallowZeroCount" : "false", "action" : "rerender" } }, "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1454082,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableKudosForAnonUser" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); ], "action" : "rerender" { "revokeMode" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" ] "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }); ] }, ;(function($) { ], { { } LITHIUM.AjaxSupport.ComponentEvents.set({ }, { LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", "action" : "rerender" "actions" : [ "actions" : [ "eventActions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", }, { "messageViewOptions" : "1111110111111111111110111110100101001101" }, } "componentId" : "forums.widget.message-view", } ] Öffentliche dedizierte IP-Adressen werden NUR durch die Organisation RIPE auf Antrag zugewiesen. "actions" : [ { { "actions" : [ "actions" : [ "action" : "rerender" "context" : "", "truncateBodyRetainsHtml" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { }); }, count++; $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { { // Oops, not the right sequence, lets restart from the top. var handleOpen = function(event) { "action" : "rerender" }, "event" : "editProductMessage", event.preventDefault(); "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" "event" : "removeMessageUserEmailSubscription", { } if ( !watching ) { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ] Tragen Sie im Eingabefeld "Bezeichnung" einen beliebigen Namen für die Portfreigabe ein. "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv/thread-id/227683","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QkdsebczuwgDqeGHVAmnAo-LUU0W9eBXMNI-ZoVn618. "context" : "", } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "QuickReply", { '; } } "event" : "ProductAnswerComment", "event" : "removeThreadUserEmailSubscription", ], { } { "action" : "rerender" }, { } }, "componentId" : "forums.widget.message-view", } "event" : "addThreadUserEmailSubscription", ] "event" : "kudoEntity", { So buchst Du sie: Bestell Internet & Phone Business oder Internet Business. }); LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_721c9deca50144_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv/thread-id/227683&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); lithadmin: [] }, }, } } "context" : "", }, "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", return; "context" : "", "disableLinks" : "false", { { "entity" : "1454155", "actions" : [ { "activecastFullscreen" : false, Dann besuch unseren Vodafone Hilfe-Bereich. "action" : "rerender" "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "kudoEntity", ] var key = e.keyCode; { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-message-uid" if ( count == neededkeys.length ) { Du brauchst einen eigenen Internet & Phone-Router oder WLAN-Router mit einer Ethernet-Schnittstelle.